Web stats for Gulzartravel - gulzartravel.com
Umrah Packages From Pakistan. Umrah Packages 2013 Pakistan, Cheap umrah flights 2013 from pakistan, Book cheap umrah packages from pakistan 2013, Pakistan Umrah Packages 2013 Dubai Thailand Singapore Malaysia Tours packages from Pakistan
Traffic Report of Gulzartravel
| Daily Unique Visitors: | 269 |
| Daily Pageviews: | 538 |
Estimated Valuation
| Income Per Day: | $ 2.00 |
| Estimated Worth: | $ 480.00 |
Search Engine Indexes
| Google Indexed Pages: | 112 |
| Yahoo Indexed Pages: | 8 |
| Bing Indexed Pages: | 8 |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | 20 |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | No Risk Issues |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | 1,787,495 |
| Domain Authority: | Not Applicable |
PageSpeed Score
Siteadvisor Rating
No Risk Issues
Where is gulzartravel.com server located?
Hosted IP Address:
64.235.47.65
Hosted Country:
US
Location Latitude:
36.175Location Longitude:
-115.137Social Engagement
| Facebook Shares: | 17 |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | 18 |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 64.235.47.65)
Easy Quran Online | Quran Learning | Quran Tajweed Tutor | Home Classes
Easy Quran Online aim is to facilitate Muslims to learn Quran with tajweed. We provide one on one online Quran tutoring from highly qualified, well versed and well trained online Quran teachers, in the comfort of your own home. You can try three FREE 3 days trial lessons to evaluate our online Quran learning service.
18,761,389 
$ 8.95
Online Newspaper of British Pakistani Kashmiri Community
Kashmir Link London is an independent news organization in the UK, publishing activities of overseas communities particularly Kashmiris, Pakistanis, I
1,029,794 $ 720.00
Domain Information for gulzartravel.com
| Domain Registrar: |
CLICK REGISTRAR, INC. D/B/A PUBLICDOMAINREGISTRY.COM
|
|---|---|
| Registration Date: | 2008-08-06 1 decade 5 years 8 months ago |
| Last Modified: | 2012-10-06 1 decade 1 year 6 months ago |
| Expiration Date: | 2013-08-06 1 decade 8 months 1 week ago |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.futuresol.net |
|
216.108.226.161 |
United States
|
| ns2.futuresol.net |
|
216.108.226.161 |
United States
|
Similarly Ranked Websites to Gulzartravel
Home | SR Tech Services - UAE
SR Tech Services is a company established in UAE providing installation, renovation and maintenance services on Elevators, Escalators, Central A/c and Automatic doors.
1,787,503 $ 480.00
Homebrew Equipment Deals
Find the best home brewing supplies and the best gifts for beer lovers.
1,787,508 $ 480.00
WordPress.com — Buradan Ücretsiz bir Blog alın
- kocaelizmitsatilikarsadairevfiyatlari.wordpress.com
sahibinden satılık kocaeli izmit arsa, daire, konut, ev, villa, yat, tekne fiyatları başiskele, çayırova, darıca, derince, dilovası, gebze, gölcük, izmit, kandıra, karamürsel, kartepe, körfez bulabilirsiniz.
1,787,508 $ 480.00
Buy Handmade Shoes,Bags,Accessories Online for Men & Women | Kethini
Kethini,makers of hand made shoes,bags,accessories for men & women,aims to cater the young urban Indian consumer needs by offering the highest quality stuff with innovative material and fresh new designs.
1,787,508 $ 480.00